PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A03G1813
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 243aa    MW: 26420.3 Da    PI: 7.5025
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A03G1813genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.46.5e-0888134551
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                  k  +r   NReA r++R++ ka+ + Le++v  L a N++L k+l+ 
  Gh_A03G1813  88 KSKKRPLGNREAVRKYREKVKARAASLEDEVMRLRAVNQQLLKRLQG 134
                  77899999**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.3E-884151IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-1285152No hitNo description
PfamPF077166.9E-1485141IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.53186133IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.16E-688134No hitNo description
CDDcd146868.25E-990143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MDDGELDFSN QEVFSGNNMG DIPSSCSMDS FFDELLNDSH ACTHTHTCNP PGPDNSHTHT  60
CFHVHTKIVP ASTEDKASID DTAGSKEKSK KRPLGNREAV RKYREKVKAR AASLEDEVMR  120
LRAVNQQLLK RLQGQAALEA EVARLKCLLV DIRGRIEGEI GSFPYQKSAT AVNDYNSGAK  180
ELSTGGAGSG GCNGNSSGPK RRKGVRPATA AQVEVNDNGF GSVRQSKQQE KAQEAMQFAY  240
YLP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.138430.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480469.11e-125PREDICTED: uncharacterized protein LOC105795405
SwissprotQ8VY767e-92BZP19_ARATH; Basic leucine zipper 19
TrEMBLA0A0D2SNA51e-125A0A0D2SNA5_G
STRINGVIT_03s0038g02420.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20362879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.15e-93bZIP family protein